- Recombinant Drosophila ananassae Calcium channel flower (flower)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1045919
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 20,756 Da
- E Coli or Yeast
- Calcium channel flower (flower)
- 1-195
- GF10375, dana_GLEANR_10330
Sequence
MSFAEKITGLLARPNQQDPVGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVISILTLNVGCLVAGIIQMVAGFVVMLLEAPCCFVCIEKVNDIADKVDSKPMYFRAGLYCAMAVPPIFMCFGLASLFGSGLIFATGVIYGMMALGKKASAEDMRAAAQQSYAGNATPQTTNDRAGIVNNAQPFSFTGAVGTDSNV